The domain within your query sequence starts at position 186 and ends at position 225; the E-value for the Nore1-SARAH domain shown below is 1e-20.
AFSLPELQNFLRILDKEEDEQLQSLKRRYTAYRQKLEEAL
Nore1-SARAH |
---|
PFAM accession number: | PF16517 |
---|---|
Interpro abstract (IPR011524): | The SARAH (Sav/Rassf/Hpo) domain is found at the C terminus in three classes of eukaryotic tumour suppressors that give the domain its name. In the Sav (Salvador) and Hpo (Hippo) families, the SARAH domain mediates signal transduction from Hpo via the Sav scaffolding protein to the downstream component Wts (Warts); the phosphorylation of Wts by Hpo triggers cell cycle arrest and apoptosis by down-regulating cyclin E, Diap 1 and other targets [ (PUBMED:14654011) ]. The SARAH domain is also involved in dimerisation, as in the human Hpo orthologue, Mst1, which homodimerises via its C-terminal SARAH domain. The SARAH domain is found associated with other domains, such as protein kinase domains, WW/rsp5/WWP domain ( IPR001202 ), C1 domain ( IPR002219 ), LIM domain ( IPR001781 ), or the Ras-associating (RA) domain ( IPR000159 ). |
GO process: | signal transduction (GO:0007165) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nore1-SARAH