The domain within your query sequence starts at position 1 and ends at position 78; the E-value for the Not3 domain shown below is 1.1e-28.

XLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQ
FESEVESLSVQTRKKKGD

Not3

Not3
PFAM accession number:PF04065
Interpro abstract (IPR007207):

The Ccr4-Not complex (Not1, Not2, Not3, Not4 and Not5) is a global regulator of transcription that affects genes positively and negatively and is thought to regulate transcription factor TFIID [ (PUBMED:7926748) ]. This domain is the N-terminal region of the Not proteins.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Not3