The domain within your query sequence starts at position 3 and ends at position 232; the E-value for the Not3 domain shown below is 6.5e-99.

DKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQI
KTWVASNEIKDKRQLIENRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKE
EVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRM
LETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLE

Not3

• PFAM accession number: PF04065
• Interpro abstract (IPR007207):

  The Ccr4-Not complex (Not1, Not2, Not3, Not4 and Not5) is a global regulator of transcription that affects genes positively and negatively and is thought to regulate transcription factor TFIID [ (PUBMED:7926748) ]. This domain is the N-terminal region of the Not proteins.

• GO process: regulation of transcription, DNA-templated (GO:0006355)
• GO component: nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Not3