The domain within your query sequence starts at position 187 and ends at position 263; the E-value for the Nse4_C domain shown below is 1.2e-29.
TPMSFFDFVVDPHSFPRTVENIFHVSFIIRDGFARIRLDQDRLPIIEPVINEESEGIDHN IQIRSQGIIALSYHDWE
Nse4_C |
 |
|---|
| PFAM accession number: | PF08743 |
|---|---|
| Interpro abstract (IPR014854): | Nse4 is a component of the Smc5/6 DNA repair complex. It forms interactions with Smc5 and Nse1 [ (PUBMED:15331764) ]. The exact function of this highly conserved C-terminal domain is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nse4_C