The domain within your query sequence starts at position 424 and ends at position 628; the E-value for the Nuc_H_symport domain shown below is 2.6e-11.
EETPTAATHSQAFNFWDLIKLLCSVQYGSVLFVAWFMGFGYGFVFTFLYWHLEDLNGTTT LFGVCSVLSHVSELTAYFFSHKLIELIGHIRVLYIGLACNTARYIYISYLENAWTVLPME VLQGVTHAAIWAACISYLSAAVPPELRTSAQGILQGLHLGLGRGCGAMIGGVLVNYFGAA ATFRGIGMACLVILLLFALIQWLAV
Nuc_H_symport |
![]() |
---|
PFAM accession number: | PF03825 |
---|---|
Interpro abstract (IPR004740): | This family of proteins transports nucleosides at a high affinity. The transport mechanism is driven by proton motive force. This family includes nucleoside permease (NupG) and xanthosine permease (XapB) from Escherichia coli. |
GO process: | nucleoside transport (GO:0015858) |
GO component: | integral component of membrane (GO:0016021) |
GO function: | nucleoside transmembrane transporter activity (GO:0005337) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nuc_H_symport