SMART: Pfam domain Nuc

The domain within your query sequence starts at position 18 and ends at position 132; the E-value for the Nuc_recep-AF1 domain shown below is 4.2e-42.

SSLNSPTGRGSMAVPSLHPSLGPGIGSPLGSPGQLHSPISTLSSPINGMGPPFSVISSPM
GPHSMSVPTTPTLGFGTGSPQLNSPMNPVSSTEDIKPPLGLNGVLKVPAHPSGNM

Nuc_recep-AF1

PFAM accession number:	PF11825
Interpro abstract (IPR021780):	Nuclear receptors (NRs) are a family of ligand-inducible transcription factors, and, like other transcription factors, they contain a distinct DNA binding domain that allows for target gene recognition and several activation domains that possess the ability to activate transcription [ (PUBMED:12893880) ]. One of these activation domains is at the N-terminal, although there are two distinct motifs within this domain, between residues 20-36 and between 74 and the end of this domain, which are the binding regions. One of the co-activators is TIF1beta, which appears to bind at the first motif [ (PUBMED:19321449) ].

PFAM accession number:

PF11825

Interpro abstract (IPR021780):

Nuclear receptors (NRs) are a family of ligand-inducible transcription factors, and, like other transcription factors, they contain a distinct DNA binding domain that allows for target gene recognition and several activation domains that possess the ability to activate transcription [ (PUBMED:12893880) ]. One of these activation domains is at the N-terminal, although there are two distinct motifs within this domain, between residues 20-36 and between 74 and the end of this domain, which are the binding regions. One of the co-activators is TIF1beta, which appears to bind at the first motif [ (PUBMED:19321449) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nuc_recep-AF1