The domain within your query sequence starts at position 107 and ends at position 155; the E-value for the Nuc_sug_transp domain shown below is 1.6e-13.

HQSRHLRCTSWKEFSSFMKWSIPAFLYFLDNLIVFYVLSYLQPAASELD

Nuc_sug_transp

Nuc_sug_transp
PFAM accession number:PF04142
Interpro abstract (IPR007271):

This family of membrane proteins transport nucleotide sugars from the cytoplasm into golgi vesicles. SLC35A1 ( P78382 ) transports CMP-sialic acid, SLC35A2 ( P78381 ) transports UDP-galactose and SLC35A3 ( Q9Y2D2 ) transports UDP-GlcNAc [ (PUBMED:25210595) ].

GO process:pyrimidine nucleotide-sugar transmembrane transport (GO:0090481)
GO component:integral component of membrane (GO:0016021), Golgi membrane (GO:0000139)
GO function:pyrimidine nucleotide-sugar transmembrane transporter activity (GO:0015165)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nuc_sug_transp