The domain within your query sequence starts at position 13 and ends at position 195; the E-value for the Nucleoplasmin domain shown below is 6.1e-58.
RPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPI KVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEDEED VKLLGMSGKRSAPGGGNKVPQKKVKLDEDDEDDDEDDEDDEDDDDDDFDEEETEEKVPVK KGQ
Nucleoplasmin |
![]() |
---|
PFAM accession number: | PF03066 |
---|---|
Interpro abstract (IPR024057): | This entry represents the core structural domain for the nucleoplasmin (Np) family of histone chaperone proteins. This core domain is formed by an 8-stranded beta barrel [ (PUBMED:15576029) ]. The three branches of the Np family, including nucleophosmin (NO38/B23), nucleoplasmin (Np), and nucleoplasmin-like proteins (NLP), bind core histones and assemble nucleosomes in vitro assays. Even though they have different histone preferences, it has been suggested that Np family members may share a general mechanism for binding histones [ (PUBMED:15576029) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nucleoplasmin