The domain within your query sequence starts at position 27 and ends at position 115; the E-value for the Nup188 domain shown below is 1.1e-27.

RELNQIEAELNKYWQRLLEGLSYYKPPSPSSAERVKANKDVASPLKELGLRVSKFLGLDE
EQSVQLLQCYLQEDYRGTRDSLKLNSPCK

Nup188

Nup188
PFAM accession number:PF10487
Interpro abstract (IPR018864):

This is one of the many peptides that make up the nucleoporin complex (NPC), and is found across eukaryotes [ (PUBMED:11029043) ]. The Nup188 subcomplex (Nic96p-Nup188p-Nup192p-Pom152p) is one of at least six that make up the NPC, and as such is symmetrically localised on both faces of the NPC at the nuclear end, being integrally bound to the C terminus of Pom34p [ (PUBMED:16361228) ].

GO function:structural constituent of nuclear pore (GO:0017056)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Nup188