The domain within your query sequence starts at position 40 and ends at position 381; the E-value for the O-FucT domain shown below is 4.8e-93.
LLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLE PLQAYHRVVSLEDFMENLAPSHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQ FHVSFNKSELFTGISFSASYKEQWTQRFPAKEHPVLALPGAPAQFPVLEEHRELQKYMVW SDEMVRTGEALISAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRST ATPLTMTMCLPDLKEIQRAVTLWVRALNARSVYIATDSESYVSEIQQLFKDKVRVVSLKP EVAQIDLYILGQADHFIGNCVSSFTAFVKRERDLHGRQSSFF
O-FucT |
![]() |
---|
PFAM accession number: | PF10250 |
---|---|
Interpro abstract (IPR019378): | This is a family of conserved proteins representing the enzyme responsible for adding O-fucose to EGF (epidermal growth factor-like) repeats. Six highly conserved cysteines are present as well as a DXD-like motif (ERD), conserved in mammals, Drosophila, and Caenorhabditis elegans. Both features are characteristic of several glycosyltransferase families. The enzyme is a membrane-bound protein released by proteolysis and, as for most glycosyltransferases, is strongly activated by manganese [ (PUBMED:11524432) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry O-FucT