The domain within your query sequence starts at position 19 and ends at position 74; the E-value for the OATP domain shown below is 3.4e-16.

IKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIDTNMKQR

OATP

OATP
PFAM accession number:PF03137
Interpro abstract (IPR004156):

This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs). Several have been identified mostly in human and rat. Different OATPs vary in tissue distribution and substrate specificity. Since the numbering of different OATPs in particular species was based originally on the order of discovery, similarly numbered OATPs in humans and rats did not necessarily correspond in function, tissue distribution and substrate specificity (in spite of the name, some OATPs also transport organic cations and neutral molecules) so a scheme of using digits for rat OATPs and letters for human ones was introduced [ (PUBMED:10873595) ]. Prostaglandin transporter (PGT) proteins are also considered to be OATP family members. In addition, the methotrexate transporter OATK is closely related to OATPs. This family also includes several predicted proteins from Caenorhabditis elegans and Drosophila melanogaster. This similarity was not previously noted. All characterized OATPs are predicted to have 12 transmembrane domains and are sodium-independent transport systems [ (PUBMED:23506880) ].

GO process:transmembrane transport (GO:0055085)
GO component:membrane (GO:0016020)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OATP