The domain within your query sequence starts at position 18 and ends at position 118; the E-value for the OCRL_clath_bd domain shown below is 1.5e-47.
LEMKGPLREPCVLTLARRNGQYELIIQLHGKEQHVQDIIPINSHFRCVQEAEETLLIDIA SNSGCKIRVQGDWTRERHFEIPDEERCLKFLSEVLEAQEAQ
OCRL_clath_bd |
![]() |
---|
PFAM accession number: | PF16726 |
---|---|
Interpro abstract (IPR031995): | This domain is a clathrin binding domain found at the N terminus of inositol polyphosphate 5-phosphatase OCRL. It has a PH domain-like fold [ (PUBMED:19536138) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OCRL_clath_bd