SMART: Pfam domain ODR4-like

The domain within your query sequence starts at position 28 and ends at position 386; the E-value for the ODR4-like domain shown below is 7.1e-113.

GLLIGQCSSQKDYVILATRTPPKEEQNDKVKQPRAKLDNLDEEWATEHASQVSRMLPGGL
VVLGIFIITTLELADDFQNALRRLIFSMEKSMSRKRLWDVTEDEVSERVTLHICSSTKKI
SCRTYDVQDPKSSARPADWKYQSRVSASWLSLDCTVHVNIHIPLSATSVSYTLEKNTKSG
LTRWAKQIENGVYLINGQVKGNDCDLLEGQKKSRGNTQATAHSFDVRVLTQLLLNSDHRS
TATVQICSGSVNLRGNVKCRAYIHSNRPKVKDAVQAVKRDILNTVADRCEILFEDLLLNE
IPEKKNYELPQRVFVPLPGSTVMLCDYKFGDESAEEIRDHFSEMLDHEIQIEDLEIAEE

ODR4-like

PFAM accession number:	PF14778
Interpro abstract (IPR029454):	This entry represents the odorant response abnormal protein 4 (ODR-4)-like proteins from animals and plants. In C.elegans, ODR-4 and ODR-8 are required for localising a subset of odorant GPCRs to the cilia of olfactory neurons [ (PUBMED:9590179) ]. Olfactory receptors (ORs) are synthesised in endoplasmic reticulum of the olfactory neurons, trafficked to the cell surface membrane and transported to the tip of the olfactory cilium, where they bind with odorants. Various accessory proteins are required for proper targetting of different ORs to the cell membrane. ODR-4 was the first accessory protein to be described. ODR-4 plays a role in nociceptive neurons to mediate avoidance of high oxygen [ (PUBMED:16581509) ].

PFAM accession number:

PF14778

Interpro abstract (IPR029454):

This entry represents the odorant response abnormal protein 4 (ODR-4)-like proteins from animals and plants.

In C.elegans, ODR-4 and ODR-8 are required for localising a subset of odorant GPCRs to the cilia of olfactory neurons [ (PUBMED:9590179) ]. Olfactory receptors (ORs) are synthesised in endoplasmic reticulum of the olfactory neurons, trafficked to the cell surface membrane and transported to the tip of the olfactory cilium, where they bind with odorants. Various accessory proteins are required for proper targetting of different ORs to the cell membrane. ODR-4 was the first accessory protein to be described. ODR-4 plays a role in nociceptive neurons to mediate avoidance of high oxygen [ (PUBMED:16581509) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry ODR4-like