SMART: Pfam domain OFCC1

The domain within your query sequence starts at position 5 and ends at position 113; the E-value for the OFCC1 domain shown below is 1.3e-57.

KFQQKAVKQTKQKKSTSAEFLMVKEYTDATEGAGNPGFNMSSPELPAHQTPQEKVVRHDM
LDHTLATHQQKSRLPASAGPKGNEYSRNYFDPLTEEEINSRQCRMEVSR

OFCC1

PFAM accession number:	PF15680
Interpro abstract (IPR031390):	This family of proteins is found in eukaryotes. Proteins in this family are typically between 125 and 276 amino acids in length. The family includes OFCC1 (orofacial cleft 1 candidate gene 1 protein), a potentially causal gene for orofacial cleft in humans [ (PUBMED:15218257) ]. However, ablation of the gene had no effects in head development in mice [ (PUBMED:22242126) ]. Mutations in the homologous Opo gene result in eye malformation in medaka fish [ (PUBMED:19502481) ].

PFAM accession number:

PF15680

Interpro abstract (IPR031390):

This family of proteins is found in eukaryotes. Proteins in this family are typically between 125 and 276 amino acids in length. The family includes OFCC1 (orofacial cleft 1 candidate gene 1 protein), a potentially causal gene for orofacial cleft in humans [ (PUBMED:15218257) ]. However, ablation of the gene had no effects in head development in mice [ (PUBMED:22242126) ]. Mutations in the homologous Opo gene result in eye malformation in medaka fish [ (PUBMED:19502481) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry OFCC1