The domain within your query sequence starts at position 9 and ends at position 136; the E-value for the OPA3 domain shown below is 1.7e-48.
AKLFYLGIRQVSKPLANRIKDAARRSEFFKTYICLPPAQLYHWVEMRTKMRIMGFRGTTI KPLNEEAAAELGAELLGEATIFIVGGGCLVLEYWRHQTQQRNKEEEQRAAWNALQDEVGR LALALEAL
OPA3 |
---|
PFAM accession number: | PF07047 |
---|---|
Interpro abstract (IPR010754): | OPA3 deficiency causes type III 3-methylglutaconic aciduria (MGA) in humans. This disease manifests with early bilateral optic atrophy, spasticity, extrapyramidal dysfunction, ataxia, and cognitive deficits, but normal longevity [ (PUBMED:12126933) ]. This family consists of several optic atrophy 3 (OPA3) proteins and related proteins from other eukaryotic species, the function is unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OPA3