The domain within your query sequence starts at position 21 and ends at position 89; the E-value for the OTOS domain shown below is 9.3e-42.
AKPMPEEADPHTQPPAMPYWPFSTSDFWNYVQYFQTQGAYPQIEDMARTFFAHFPLGSTL GFHVPYQED
OTOS |
 |
|---|
| PFAM accession number: | PF15182 |
|---|---|
| Interpro abstract (IPR028224): | Otospiralin, has a role in maintaining the neurosensory epithelium of the inner ear [ (PUBMED:11880501) ]. Otospiralin is also expressed in the central nervous system, where could be involved in signalling pathways and play a role in repair mechanisms [ (PUBMED:18832023) ]. |
| GO process: | sensory perception of sound (GO:0007605) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry OTOS