The domain within your query sequence starts at position 419 and ends at position 518; the E-value for the Occludin_ELL domain shown below is 8.8e-35.

YPPITSDQQRQLYKRNFDAGLQEYKSLQAELDDVNKELSRLDKELDDYREESEEYMAAAD
EYNRLKQVKGSADYKSKRNYCKQLKSKLSHIKRMVGDYDR

Occludin_ELL

Occludin_ELL
PFAM accession number:PF07303
Interpro abstract (IPR010844):

This represents a conserved region approximately 100 residues long within eukaryotic occludin proteins and the RNA polymerase II elongation factor ELL. Occludin is an integral membrane protein that localises to tight junctions [ (PUBMED:8276896) ], while ELL is an elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by polymerase at multiple sites along the DNA [ (PUBMED:8596958) ]. This shared domain is thought to mediate protein interactions [ (PUBMED:8276896) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Occludin_ELL