The domain within your query sequence starts at position 22 and ends at position 68; the E-value for the Opiods_neuropep domain shown below is 8.7e-20.

DCLSLCSLCAVRIQDGPRPINPLICSLECQDLVPPSEEWETCRGFSS

Opiods_neuropep

• PFAM accession number: PF01160
• Interpro abstract (IPR006024):

  Vertebrate endogenous opioid neuropeptides are released by post-translational proteolytic cleavage of precursor proteins. The precursors consist of the following components: a signal sequence that precedes a conserved region of about 50 residues; a variable-length region; and the sequence of the neuropeptide itself. Three types of precursor are known: preproenkephalin A (gene PENK), which is processed to produce 6 copies of Met-enkephalin, plus Leu-enkephalin; preproenkephalin B (gene PDYN), which is processed to produce neoendorphin, dynorphin, leumorphin, rimorphin and Leu-enkephalin; and prepronocipeptin (gene PNOC), whose processing produces nociceptin (orphanin FQ) and two other potential neuropeptides.

  Sequence analysis reveals that the conserved N-terminal region of the precursors contains 6 cysteines, which are probably involved in disulphide bond formation. It is speculated that this region might be important for neuropeptide processing [ (PUBMED:8710928) ].

• GO process: neuropeptide signaling pathway (GO:0007218)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Opiods_neuropep