The domain within your query sequence starts at position 283 and ends at position 405; the E-value for the Orn_DAP_Arg_deC domain shown below is 3e-26.
LAVNIIAKKVVENDKFSSGVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTIPEVHKKY KEDEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPA IYF
Orn_DAP_Arg_deC |
![]() |
---|
PFAM accession number: | PF00278 |
---|---|
Interpro abstract (IPR022643): | This entry represents the C-terminal region of the Orn/DAP/Arg decarboxylases. These enzymes are collectively known as group IV decarboxylases [ (PUBMED:8181483) ]. Pyridoxal-dependent decarboxylases acting on ornithine, lysine, arginine and related substrates can be classified into two different families on the basis of sequence similarities [ (PUBMED:3143046) (PUBMED:8181483) ]. Members of this family while most probably evolutionary related, do not share extensive regions of sequence similarities. The proteins contain a conserved lysine residue which is known, in mouse ODC [ (PUBMED:1730582) ], to be the site of attachment of the pyridoxal-phosphate group. The proteins also contain a stretch of three consecutive glycine residues and has been proposed to be part of a substrate- binding region [ (PUBMED:2198270) ]. |
GO function: | catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Orn_DAP_Arg_deC