The domain within your query sequence starts at position 17 and ends at position 189; the E-value for the Oscp1 domain shown below is 1.1e-83.
MLYVLDQRLRAQNIPGDKARKVLNDIISTMFNRKFMDELFKPQELYSKKALRTVYDRLAH ASIMRLNQASMDKLYDLMTMAFKYQVLLCPRPKDVLLVTFNHLDAIKGFVQDSPTVIHQV DETFRQLSEVYGKLSEGEFQLIRQTLLNFFQDLHIRVSTFLKDKVQNSNGRFV
Oscp1 |
---|
PFAM accession number: | PF10188 |
---|---|
Interpro abstract (IPR019332): | Organic solute carrier protein 1, or Oscp1, is a family of proteins conserved from plants to humans. It is called organic solute transport protein or oxido-red-nitro domain-containing protein 1, however no reference could be find to confirm the function of the protein. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Oscp1