The domain within your query sequence starts at position 131 and ends at position 173; the E-value for the Oxidored-like domain shown below is 1e-13.

PCSLPPELEPPTNCCMSGCPNCVWVDYAEALLRLYQDGGEKAL

Oxidored-like

• PFAM accession number: PF09791
• Interpro abstract (IPR019180):

  This entry represents the N-terminal domain of various oxidoreductase-like proteins whose exact function is, as yet, unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry Oxidored-like