The domain within your query sequence starts at position 131 and ends at position 173; the E-value for the Oxidored-like domain shown below is 1e-13.
PCSLPPELEPPTNCCMSGCPNCVWVDYAEALLRLYQDGGEKAL
Oxidored-like |
---|
PFAM accession number: | PF09791 |
---|---|
Interpro abstract (IPR019180): | This entry represents the N-terminal domain of various oxidoreductase-like proteins whose exact function is, as yet, unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Oxidored-like