The domain within your query sequence starts at position 15 and ends at position 56; the E-value for the Oxidored-like domain shown below is 2.5e-14.
RLKPVEPLPSQCCGSGCSPCVFDLYYRDLERWETARARNDRS
Oxidored-like |
![]() |
---|
PFAM accession number: | PF09791 |
---|---|
Interpro abstract (IPR019180): | This entry represents the N-terminal domain of various oxidoreductase-like proteins whose exact function is, as yet, unknown. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry Oxidored-like