The domain within your query sequence starts at position 27 and ends at position 158; the E-value for the P4Ha_N domain shown below is 3.1e-44.
TSIGHMTDLIYAEKDLVQSLKEYILVEEAKLAKIKSWASKMEALTSRSAADPEGYLAHPV NAYKLVKRLNTDWPALGDLVLQDASAGFVANLSVQRQFFPTDEDESGAARALMRLQDTYK LDPDTISRGELP
P4Ha_N |
![]() |
---|
PFAM accession number: | PF08336 |
---|---|
Interpro abstract (IPR013547): | The members found in this entry are eukaryotic proteins, and include all three isoforms of the prolyl 4-hydroxylase alpha subunit. This enzyme ( EC 1.14.11.2 ) is important in the post-translational modification of collagen, as it catalyses the formation of 4-hydroxyproline. In vertebrates, the complete enzyme is an alpha2-beta2 tetramer; the beta-subunit is identical to protein disulphide isomerase [ (PUBMED:7753822) (PUBMED:14500733) (PUBMED:2552442) (PUBMED:11850189) ]. The function of the N-terminal region featured in this family does not seem to be known. |
GO process: | oxidation-reduction process (GO:0055114) |
GO component: | endoplasmic reticulum (GO:0005783) |
GO function: | oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (GO:0016702), procollagen-proline 4-dioxygenase activity (GO:0004656) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry P4Ha_N