The domain within your query sequence starts at position 27 and ends at position 160; the E-value for the P4Ha_N domain shown below is 6.3e-44.

TSIGHMTDLIYAEKDLVQSLKEYILVEEAKLAKIKSWASKMEALTSRSAADPEGYLAHPV
NAYKLVKRLNTDWPALGDLVLQDASAGFVANLSVQRQFFPTDEDESGAARALMRLQDTYK
LDPDTISRGELPGT

P4Ha_N

 P4Ha_N
PFAM accession number:PF08336
Interpro abstract (IPR013547):

The members found in this entry are eukaryotic proteins, and include all three isoforms of the prolyl 4-hydroxylase alpha subunit. This enzyme ( EC 1.14.11.2 ) is important in the post-translational modification of collagen, as it catalyses the formation of 4-hydroxyproline. In vertebrates, the complete enzyme is an alpha2-beta2 tetramer; the beta-subunit is identical to protein disulphide isomerase [ (PUBMED:7753822) (PUBMED:14500733) (PUBMED:2552442) (PUBMED:11850189) ]. The function of the N-terminal region featured in this family does not seem to be known.

GO process:oxidation-reduction process (GO:0055114)
GO component:endoplasmic reticulum (GO:0005783)
GO function:oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen (GO:0016702), procollagen-proline 4-dioxygenase activity (GO:0004656)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry P4Ha_N