The domain within your query sequence starts at position 132 and ends at position 164; the E-value for the P5CR_dimer domain shown below is 2.2e-12.

VEEDLIDAVTGLSGSGPAYAFTALDALADGGVK

P5CR_dimer

P5CR_dimer
PFAM accession number:PF14748
Interpro abstract (IPR029036):

Pyrroline-5-carboxylate reductase consists of two domains, an N-terminal catalytic domain and a C-terminal dimerisation domain. This is the dimerisation domain [ (PUBMED:16233902) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry P5CR_dimer