The domain within your query sequence starts at position 166 and ends at position 270; the E-value for the P5CR_dimer domain shown below is 5.2e-37.
PESYVDIHTGLSGSGVAFVCTFSEALAEGAIKMGMPSGLAHRIAAQTLLGTAKMLQQEGK HPAQLRTDVLTPAGTTIHGLHALERGGFRAATMSAVEAATCRAKE
P5CR_dimer |
![]() |
---|
PFAM accession number: | PF14748 |
---|---|
Interpro abstract (IPR029036): | Pyrroline-5-carboxylate reductase consists of two domains, an N-terminal catalytic domain and a C-terminal dimerisation domain. This is the dimerisation domain [ (PUBMED:16233902) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry P5CR_dimer