SMART: Pfam domain PA

The domain within your query sequence starts at position 229 and ends at position 348; the E-value for the PA domain shown below is 1.1e-12.

EVSGKLVHANFGTKKDFEELSYSVNGSLVIVRAGEITFAEKVANAQSFNAIGVLIYMDKN
KFPVVEADLALFGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPNIPVQTISRAAAEKLF

PA

PFAM accession number:	PF02225
Interpro abstract (IPR003137):	The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [ (PUBMED:7674922) ]. The PA domain is also found in a plant vacuolar sorting receptor O22925 and members of the RZF family, e.g. O43567 . It has been suggested that this domain forms a lid-like structure that covers the active site in active proteases, and is involved in protein recognition in vacuolar sorting receptors [ (PUBMED:11246007) ].

PFAM accession number:

PF02225

Interpro abstract (IPR003137):

The PA (Protease associated) domain is found as an insert domain in diverse proteases, which include the MEROPS peptidase families A22B, M28, and S8A [ (PUBMED:7674922) ]. The PA domain is also found in a plant vacuolar sorting receptor O22925 and members of the RZF family, e.g. O43567 . It has been suggested that this domain forms a lid-like structure that covers the active site in active proteases, and is involved in protein recognition in vacuolar sorting receptors [ (PUBMED:11246007) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PA