The domain within your query sequence starts at position 77 and ends at position 175; the E-value for the PALP domain shown below is 4.1e-27.

ILRKIGNTPMVRINKISKNAGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERAGNLKPG
DTIIEPTSGNTGIGLALAAAVKGYRCIIVMPEKMSMEKV

PALP

PALP
PFAM accession number:PF00291
Interpro abstract (IPR001926):

This entry represent a domain found in a group of proteins of the PLP-dependent enzymes superfamily represented by the beta subunit of tryptophan synthase [ (PUBMED:10673430) ]. It is a group of diverse proteins, including threonine dehydratase, cysteine synthase, pyridoxal phosphate-dependent deaminase, etc.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PALP