The domain within your query sequence starts at position 386 and ends at position 440; the E-value for the PAP_assoc domain shown below is 1.5e-17.

SLGDLLLGFLKYYATEFDWNTQMISVREAKAIPRPDDMEWRNKYICVEEPFDGTN

PAP_assoc

 PAP_assoc
PFAM accession number:PF03828
Interpro abstract (IPR002058):

This domain is found in poly(A) polymerases and has been shown to have polynucleotide adenylyltransferase activity [ (PUBMED:15607976) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAP_assoc