The domain within your query sequence starts at position 85 and ends at position 176; the E-value for the PAXIP1_C domain shown below is 5.9e-29.
DWCVPCSDEEVELPANGQSWMPPPSEIQRLYELLATQGTLELQAEILPRRPPTPEAQSEE ERSDEEPEAKEEEEEKPHMPTEFDFDDEPMTP
PAXIP1_C |
 |
|---|
| PFAM accession number: | PF15364 |
|---|---|
| Interpro abstract (IPR028213): | PTIP-associated protein 1 (PA1), also known as PAXIP1-associated-protein-1, is found in eukaryotes. PA1 and PTIP form a stable complex, which is recruited to DNA damage sites via the RNF8-dependent pathway and is required for cell survival in response to DNA damage [ (PUBMED:19124460) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PAXIP1_C