The domain within your query sequence starts at position 62 and ends at position 117; the E-value for the PC4 domain shown below is 5.4e-26.
NMFQIGKMRYVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNMEQWSQLKEQI
PC4 |
---|
PFAM accession number: | PF02229 |
---|---|
Interpro abstract (IPR003173): | This entry represents a domain found in p15 and other PC4 family members. p15 has a bipartite structure composed of an amino-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [ (PUBMED:8062392) ]. The DNA-binding activity of the carboxy-terminal is disguised by the amino-terminal p15 domain. Activity is controlled by protein kinases that target the regulatory domain. |
GO process: | regulation of transcription, DNA-templated (GO:0006355) |
GO function: | DNA binding (GO:0003677) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PC4