The domain within your query sequence starts at position 64 and ends at position 116; the E-value for the PC4 domain shown below is 1.9e-27.

FQIGKMRYVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNMEQWSQLKEQ

PC4

PC4
PFAM accession number:PF02229
Interpro abstract (IPR003173):

This entry represents a domain found in p15 and other PC4 family members.

p15 has a bipartite structure composed of an amino-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain [ (PUBMED:8062392) ]. The DNA-binding activity of the carboxy-terminal is disguised by the amino-terminal p15 domain. Activity is controlled by protein kinases that target the regulatory domain.

GO process:regulation of transcription, DNA-templated (GO:0006355)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PC4