The domain within your query sequence starts at position 1 and ends at position 125; the E-value for the PCNA_N domain shown below is 1.4e-61.

MFEARLIQGSILKKVLEALKDLINEACWDVSSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQ

PCNA_N

PCNA_N
PFAM accession number:PF00705
Interpro abstract (IPR022648):

Proliferating cell nuclear antigen (PCNA), or cyclin, is a non-histone acidic nuclear protein [ (PUBMED:2884104) ] that plays a key role in the control of eukaryotic DNA replication [ (PUBMED:1346518) ]. It acts as a co-factor for DNA polymerase delta, which is responsible for leading strand DNA replication [ (PUBMED:2565339) ]. The sequence of PCNA is well conserved between plants and animals, indicating a strong selective pressure for structure conservation, and suggesting that this type of DNA replication mechanism is conserved throughout eukaryotes [ (PUBMED:1671766) ]. In Saccharomyces cerevisiae (Baker's yeast), POL30, is associated with polymerase III, the yeast analog of polymerase delta.

Homologues of PCNA have also been identified in the archaea (known as DNA polymerase sliding clamp) [ (PUBMED:10542158) (PUBMED:10438605) ] and in Paramecium bursaria Chlorella virus 1 (PBCV-1) and in nuclear polyhedrosis viruses.

The N-terminal and C-terminal domains of PCNA are topologically identical. Three PCNA molecules are tightly associated to form a closed ring encircling duplex DNA [ (PUBMED:8001157) ].

GO process:regulation of DNA replication (GO:0006275)
GO function:DNA binding (GO:0003677)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PCNA_N