The domain within your query sequence starts at position 6 and ends at position 87; the E-value for the PDE6_gamma domain shown below is 6e-51.
PKGEIRSATRVIGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDIT VICPWEAFNHLELHELAQYGII
PDE6_gamma |
![]() |
---|
PFAM accession number: | PF04868 |
---|---|
Interpro abstract (IPR006952): | Retinal rod and cone cGMP phosphodiesterases function as the effector enzymes in the vertebrate visual transduction cascade. This family represents the inhibitory gamma subunit [ (PUBMED:11900530) ], which is also expressed outside retinal tissues and has been shown to interact with the G-protein-coupled receptor kinase 2 signalling system to regulate the epidermal growth factor- and thrombin-dependent stimulation of p42/p44 mitogen-activated protein kinase in human embryonic kidney 293 cells [ (PUBMED:11502744) ]. |
GO process: | visual perception (GO:0007601) |
GO function: | cGMP binding (GO:0030553), 3',5'-cyclic-nucleotide phosphodiesterase activity (GO:0004114) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PDE6_gamma