The domain within your query sequence starts at position 7 and ends at position 99; the E-value for the PEN-2 domain shown below is 2.9e-43.

SNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLAPAYTEQSQIKGYVWRSAVGFLF
WVIILATWITIFQIYRPRWGALGDYLSFTIPLG

PEN-2

PEN-2
PFAM accession number:PF10251
Interpro abstract (IPR019379):

This entry is a short, 101 peptide protein, which is the smallest subunit of the gamma-secretase aspartyl protease complex. It catalyses the intra-membrane cleavage of a subset of type I transmembrane proteins. The other active constituents of the complex are presenilin (PS) nicastrin and anterior pharynx defective-1 (APH-1) protein. Presenilin enhancer-2 (PEN-2) adopts a hairpin orientation in the membrane with its N- and C-terminal domains facing the luminal/extracellular space. The C-terminal domain maintains PS stability within the complex [ (PUBMED:15953349) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PEN-2