The domain within your query sequence starts at position 4 and ends at position 230; the E-value for the PEX11 domain shown below is 4.5e-60.
LNRLASALESHRVRDRLIRTLGYCCQLIGGVLVEQCPNRSEVGRRLLVVSAQFNHCRTVL RLFDDLAMFVYTKQYGLGTKEEDIFIRWLSVLSNVTDQLYYPCEHIAWAADAKVLRVDSA WWWTLNTALWTLSLLLGAVKALWTMLKLRQKLRSPTGTSASQLPRSKRRAMEARICSEVL TLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILSTCQAV
PEX11 |
![]() |
---|
PFAM accession number: | PF05648 |
---|---|
Interpro abstract (IPR008733): | This family consists of several peroxisomal biogenesis factor 11 (PEX11) proteins from several eukaryotic species. The PEX11 peroxisomal membrane proteins promote peroxisome division in multiple eukaryotes [ (PUBMED:12417726) ]. PEX11 genes in rice have diversification not only in sequences but also in expression patterns under normal and various stress conditions [ (PUBMED:18291602) ]. |
GO process: | peroxisome fission (GO:0016559) |
GO component: | integral component of peroxisomal membrane (GO:0005779) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PEX11