The domain within your query sequence starts at position 275 and ends at position 362; the E-value for the PH_BEACH domain shown below is 1e-21.

CQLVTVVAVVPGLLEITTQHVYFYDGSTERVETEEGIGHDFRRPLAQLREVHLRRFNLRR
SALELFFIDQSNYFLNFPHKVAASSASS

PH_BEACH

PH_BEACH
PFAM accession number:PF14844
Interpro abstract (IPR023362):

The BEACH domain is found in eukaryotic proteins that have diverse cellular functions ranging from lysosomal traffic to apoptosis and cytokinesisin vesicle trafficking, membrane dynamics, and receptor signaling. The name BEACH is derived from BEige And Chediak-Higashi syndrome.

This entry represents a domain with a fold similar to that of the PH (pleckstrin homology) domain, despite displaying little sequence homology with canonical PH domains. Furthermore, this domain is incapable of binding phospholipids [ (PUBMED:15554694) ]. This domain is found preceding the BEACH domain in beige-like and BEACH-domain containing proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PH_BEACH