SMART: Pfam domain PH

The domain within your query sequence starts at position 22 and ends at position 103; the E-value for the PH_TFIIH domain shown below is 8.5e-29.

RQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGKAKIQLQLVLHAGDTT
NFHFSNESTAVKERDAVKDLLQ

PH_TFIIH

PFAM accession number:	PF08567
Interpro abstract (IPR013876):	The N-terminal region of the TFIIH basal transcription factor complex p62 subunit (BTF2-p62) forms an interaction with the 3' endonuclease XPG, which is essential for activity. The 3' endonuclease XPG is a major component of the nucleotide excision repair machinery. The structure of the N-terminal region reveals that it adopts a pleckstrin homology (PH) fold [ (PUBMED:15195146) (PUBMED:15909982) ].

PFAM accession number:

PF08567

Interpro abstract (IPR013876):

The N-terminal region of the TFIIH basal transcription factor complex p62 subunit (BTF2-p62) forms an interaction with the 3' endonuclease XPG, which is essential for activity. The 3' endonuclease XPG is a major component of the nucleotide excision repair machinery. The structure of the N-terminal region reveals that it adopts a pleckstrin homology (PH) fold [ (PUBMED:15195146) (PUBMED:15909982) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PH_TFIIH