The domain within your query sequence starts at position 89 and ends at position 158; the E-value for the PIG-H domain shown below is 6.7e-25.
TLLIIDSLGIQMTSSYASGKESTTFIEMDKVKDIIINEAIYMQKVIYYLCILLKEPGKPH EISRVVPVFQ
PIG-H |
 |
|---|
| PFAM accession number: | PF10181 |
|---|---|
| Interpro abstract (IPR019328): | This entry represents a conserved domain found in PIG-H proteins. PIG-H is a family of conserved proteins that complexes with three other proteins to form the GPI-GnT (glycosylphosphatidylinositol anchor biosynthesis transferase) complex. It appears to be a peripheral membrane protein that faces the cytoplasm and which is involved in the first step in GPI anchor formation. |
| GO function: | phosphatidylinositol N-acetylglucosaminyltransferase activity (GO:0017176) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIG-H