The domain within your query sequence starts at position 43 and ends at position 135; the E-value for the PIG-P domain shown below is 5.6e-36.
PERAIYGFVLFLSSQFGFILYLVWAFVPESWLNSLGLTYWPQKYWAVALPVYLLITVVIG YVLLFGINMMSTSPLDSIHTITGISIVSHQAGE
PIG-P |
---|
PFAM accession number: | PF08510 |
---|---|
Interpro abstract (IPR013717): | PIG-P (phosphatidylinositol N-acetylglucosaminyltransferase subunit P) is an enzyme involved in GPI anchor biosynthesis [ (PUBMED:10944123) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIG-P