The domain within your query sequence starts at position 23 and ends at position 207; the E-value for the PIH1 domain shown below is 1.8e-50.

RFQELLLKASKELQQAQTARPDSTQIQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVT
EDELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELV
VTIAREGLEDKYGLQLNPEWRMLKYRSFLGSISQQNIRSQQRPRIQELGTLDASGSLGTC
HGPER

PIH1

PIH1
PFAM accession number:PF08190
Interpro abstract (IPR012981):

Proteins containing this domain include kintoun, Saccharomyces cerevisiae PIH1 (protein interacting with Hsp90 1, also known as Nop17) and PIH1 domain-containing proteins.

Kintoun is required for cytoplasmic pre-assembly of axonemal dyneins, thereby playing a central role in motility in cilia and flagella. It involved in pre-assembly of dynein arm complexes in the cytoplasm before intraflagellar transport loads them for the ciliary compartment [ (PUBMED:19052621) ].

PIH1 is a component of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1), which interacts with Hsp90 to mediate assembly large protein complexes such as box C/D snoRNPs and RNA polymerase II [ (PUBMED:18268103) ]. PTH1 is also involved in pre-rRNA processing and required for the NOP58-snoRNA interaction [ (PUBMED:15670595) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIH1