The domain within your query sequence starts at position 38 and ends at position 230; the E-value for the PIP49_C domain shown below is 1.4e-61.

AWSLLQQEEYVYFSLLPDLSRHILPVLGSCGHFYAVEYLAAGSPHHKALFPLDDAGQAQA
ISHIALSFLDMVSHFDSDFSHRLHLCDVKPENFAIKRDFTVVAIDVDMAFFEPKMREILE
QNCTGDEDCNFFDCFSKCDLRVHKCGAQRVNSNLQVICDKIFRHWFSSTHRSPAVSLQLR
LQLQQAVQECAQH

PIP49_C

PIP49_C
PFAM accession number:PF12260
Interpro abstract (IPR022049):

This is the C-terminal region of a family of FAM69 proteins from Metazoa and Viridiplantae that are active protein-kinases. The family members have a short transmembrane helix close to the N terminus, and thereafter are highly enriched with cysteines. FAM69 proteins are localised to the endoplasmic reticulum. Many members also have a short EF-hand, calcium-binding, domain just upstream of the kinase domain. The exact function of the more N-terminal family is uncertain.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIP49_C