The domain within your query sequence starts at position 1 and ends at position 73; the E-value for the PIP5K domain shown below is 3.6e-9.
KEKAKELPTLKDNDFINEGQKIYIDDNNKKIFLEKLKKDVEMRLEKRYTSWRLLTSLLIT MQKRKLPTLQKLL
PIP5K |
 |
|---|
| PFAM accession number: | PF01504 |
|---|---|
| Interpro abstract (IPR002498): | This entry represents a conserved region from the common kinase core found in the type I phosphatidylinositol-4-phosphate 5-kinase (PIP5K) family as described in [ (PUBMED:9535851) ]. This region is found in I, II and III phosphatidylinositol-4-phosphate 5-kinases (PIP5K enzymes). PIP5K catalyses the formation of phosphoinositol-4,5-bisphosphate via the phosphorylation of phosphatidylinositol-4-phosphate a precursor in the phosphinositide signalling pathway. |
| GO process: | phosphatidylinositol metabolic process (GO:0046488) |
| GO function: | phosphatidylinositol phosphate kinase activity (GO:0016307) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PIP5K