The domain within your query sequence starts at position 23 and ends at position 103; the E-value for the PLAC8 domain shown below is 1.3e-19.

WQTSLCDCFSDCGVCLCGTFCFTCLGCQVAADMNECCLCGTTVAMRTLYRTRYGIPGSIC
DDYMVTLFCPVCSVCQLKRDI

PLAC8

 PLAC8
PFAM accession number:PF04749
Interpro abstract (IPR006461):

This entry represents a group of cys-rich proteins, including cornifelin and PLAC8 from animals, MCA (MID1-COMPLEMENTING ACTIVITY) and PCR (PLANT CADMIUM RESISTANCE) from Arabidopsis and cell number regulators from maize [ (PUBMED:20400678) (PUBMED:21347707) ].

Cornifelin is part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia [ (PUBMED:15147942) (PUBMED:25377654) ]. PLAC8 is required for white adipocyte differentiation in vitro and cell number control in vivo [ (PUBMED:23155406) ].

Plant transports in this entry include MCA1, MCA2 and PCR1-12. MCA1 and MCA2 mediate Ca2+ uptake [ (PUBMED:20097794) (PUBMED:24475319) (PUBMED:21949028) ], while PCR2 is a zinc exporter involved in both zinc extrusion and long-distance zinc transport [ (PUBMED:20647347) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLAC8