The domain within your query sequence starts at position 224 and ends at position 401; the E-value for the PLDc_3 domain shown below is 1.6e-43.
QVKELGVVMYNCSCLARDLTKIFEAYWFLGQAGSSIPSTWPRSFDTRYNQETPMEICLNG TPALAYLASAPPPLCPSGRTPDLKALLNVVDSARSFIYIAVMNYLPTMEFSHPRRFWPAI DDGLRRAAYERGVKVRLLISCWGHSDPSMRSFLLSLAALHDNHTHSDIQVKLFVVPTD
PLDc_3 |
---|
PFAM accession number: | PF13918 |
---|---|
Interpro abstract (IPR032803): | This domain is found in a subset of the phospholipase D family members. Phosphatidylcholine-hydrolysing phospholipase D (PLD) isoforms are activated by ADP-ribosylation factors (ARFs). PLD produces phosphatidic acid from phosphatidylcholine, which may be essential for the formation of certain types of transport vesicles or may be constitutive vesicular transport to signal transduction pathways [ (PUBMED:8732763) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PLDc_3