The domain within your query sequence starts at position 152 and ends at position 299; the E-value for the POT1PC domain shown below is 6.7e-41.
QLCDAQPMQYYDLTCQLLGKAQVDSTAFLLKVWDGTQTVLPSWRVSTQDLTFEGDLSHIE RLQSLVVDILVYDNHVQVARSIEVGCFLRLYSLHTKLQPGNSETSSSESLRLEFHLHGGT SYGRGIRVLPDTSPCVDQLKKALEGANL
POT1PC |
![]() |
---|
PFAM accession number: | PF16686 |
---|---|
Interpro abstract (IPR032042): | This entry represents the ssDNA-binding domain found in telomere protection protein 1 (Pot1). This domain is able to accommodate heterogeneous ssDNA ligands. Pot1 is responsible for binding to and protecting the 3' single-stranded DNA (ssDNA) overhang at most eukaryotic telomeres [ (PUBMED:23201273) ]. |
GO function: | single-stranded telomeric DNA binding (GO:0043047) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry POT1PC