The domain within your query sequence starts at position 84 and ends at position 163; the E-value for the PP28 domain shown below is 3e-35.
ENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARL AIIRKQREEAARKKEEERKA
PP28 |
 |
|---|
| PFAM accession number: | PF10252 |
|---|---|
| Interpro abstract (IPR019380): | This domain is a region of 70 residues conserved in proteins from plants to humans and contains a serine/arginine rich motif. In rats the full protein is a casein kinase substrate, and this region contains phosphorylation sites for both cAMP-dependent protein kinase and casein kinase II [ (PUBMED:8615683) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PP28