The domain within your query sequence starts at position 48 and ends at position 144; the E-value for the PPP1R35_C domain shown below is 2.5e-32.
PALQSSLALSLELQNARAAVASGQFDASKAVEEQLRKSFRTRCALEETVAEGLNVPRSKR LYRDLVSLQVPEEQVLNAALREKLAMLPPQPRAPPLK
PPP1R35_C |
 |
|---|
| PFAM accession number: | PF15503 |
|---|---|
| Interpro abstract (IPR029135): | This entry represents the C terminus of protein phosphatase 1 regulatory subunit 35. This protein inhibits the serine/threonine-protein phosphatase PPP1CA [ (PUBMED:19389623) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PPP1R35_C