The domain within your query sequence starts at position 17 and ends at position 173; the E-value for the PRELI domain shown below is 4.2e-52.
ELVMAAYEKRFPTCPLIPVFLGSEVLGEWRSTDGAVHTVERSCRLRVDAPRLLRKIAGVE HVVFIQRNVLNWRERTLLIDAHNETFASRVTVKESCRYTVHPENEDWTCFEQSASLDVRS FFGFESTLEKIAMKQYTANVKRGKEVIEHYLNELISQ
PRELI |
![]() |
---|
PFAM accession number: | PF04707 |
---|---|
Interpro abstract (IPR006797): | The PRELI/MSF1 domain is an eukaryotic protein module which occurs in stand- alone form in several proteins, including the human PRELI protein and the yeast MSF1 protein, and as an amino-terminal domain in an orthologous group of proteins typified by human SEC14L1, which is conserved in all animals. In this group of proteins, the PRELI/MSF1 domain co-occurs with the CRAL-TRIO and the GOLD domains. The PRELI/MSF1 domain is approximately 170 residues long and is predicted to assume a globular alpha + beta fold with six beta strands and four alpha helices. It has been suggested that the PRELI/MSF1 domain may have a function associated with cellular membrane [ (PUBMED:12049664) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRELI