SMART: Pfam domain PRP38

The domain within your query sequence starts at position 43 and ends at position 150; the E-value for the PRP38 domain shown below is 2e-16.

KQGNVLPLWGNEKTMNLNPMILTNILSSPYFKVQLYELKTYHEVVDEIYFKVTHVEPWEK
GSRKTAGQTGMCGGVSRSSRCWNRRHCFYSILPSIQIIYPEVNSKASD

PRP38

PFAM accession number:	PF03371
Interpro abstract (IPR005037):	Members of this family are related to the pre mRNA splicing factor PRP38 from yeast [ (PUBMED:1508195) ], therefore all the members of this family could be involved in splicing. This conserved region could be involved in RNA binding. The putative domain is about 180 amino acids in length. PRP38 is a unique component of the U4/U6.U5 tri-small nuclear ribonucleoprotein (snRNP) particle and is necessary for an essential step late in spliceosome maturation [ (PUBMED:9582287) ].

PFAM accession number:

PF03371

Interpro abstract (IPR005037):

Members of this family are related to the pre mRNA splicing factor PRP38 from yeast [ (PUBMED:1508195) ], therefore all the members of this family could be involved in splicing. This conserved region could be involved in RNA binding. The putative domain is about 180 amino acids in length. PRP38 is a unique component of the U4/U6.U5 tri-small nuclear ribonucleoprotein (snRNP) particle and is necessary for an essential step late in spliceosome maturation [ (PUBMED:9582287) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry PRP38